Lineage for d3cv5a2 (3cv5 A:523-1044)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2781474Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2781620Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2781969Family b.30.5.6: alpha-mannosidase, C-terminal domain [88656] (2 proteins)
    family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family
    the supersandwich domain is elaborated with additional beta-strands and beta-sandwich subdomains
  6. 2781970Protein Golgi alpha-mannosidase II [88657] (1 species)
  7. 2781971Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [88658] (57 PDB entries)
    Uniprot Q24451 94-1107
  8. 2782008Domain d3cv5a2: 3cv5 A:523-1044 [157000]
    Other proteins in same PDB: d3cv5a1, d3cv5a3
    automatically matched to d1htya2
    complexed with mpd, nag, zn; mutant

Details for d3cv5a2

PDB Entry: 3cv5 (more details), 1.6 Å

PDB Description: golgi mannosidase ii d204a catalytic nucleophile mutant complex with 3alpha,6alpha-mannopentaose
PDB Compounds: (A:) Alpha-mannosidase 2

SCOPe Domain Sequences for d3cv5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cv5a2 b.30.5.6 (A:523-1044) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
yftlddsrwpgsgvedsrttiilgedilpskhvvmhntlphwreqlvdfyvsspfvsvtd
lannpveaqvspvwswhhdtltktihpqgsttkyriifkarvppmglatyvltisdskpe
htsyasnlllrknptslplgqypedvkfgdpreislrvgngptlafseqgllksiqltqd
sphvpvhfkflkygvrshgdrsgaylflpngpaspvelgqpvvlvtkgklessvsvglps
vvhqtimrggapeirnlvdigsldnteivmrlethidsgdifytdlnglqfikrrrldkl
plqanyypipsgmfiedantrltlltgqplggsslasgeleimqdrrlasdderglgqgv
ldnkpvlhiyrlvlekvnncvrpsklhpagyltsaahkasqslldpldkfifaenewiga
qgqfggdhpsaredldvsvmrrltkssaktqrvgyvlhrtnlmqcgtpeehtqkldvchl
lpnvarcerttltflqnlehldgmvapevcpmetaayvsshs

SCOPe Domain Coordinates for d3cv5a2:

Click to download the PDB-style file with coordinates for d3cv5a2.
(The format of our PDB-style files is described here.)

Timeline for d3cv5a2: