Lineage for d1fafa_ (1faf A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2689868Superfamily a.2.3: Chaperone J-domain [46565] (2 families) (S)
  5. 2689869Family a.2.3.1: Chaperone J-domain [46566] (7 proteins)
    Pfam PF00226
  6. 2689899Protein Large T antigen, the N-terminal J domain [46573] (2 species)
  7. 2689900Species Murine polyomavirus [TaxId:10634] [46574] (1 PDB entry)
  8. 2689901Domain d1fafa_: 1faf A: [15700]

Details for d1fafa_

PDB Entry: 1faf (more details)

PDB Description: nmr structure of the n-terminal j domain of murine polyomavirus t antigens.
PDB Compounds: (A:) large t antigen

SCOPe Domain Sequences for d1fafa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]}
mdrvlsradkerllellklprqlwgdfgrmqqaykqqslllhpdkggshalmqelnslwg
tfktevynlrmnlggtgfq

SCOPe Domain Coordinates for d1fafa_:

Click to download the PDB-style file with coordinates for d1fafa_.
(The format of our PDB-style files is described here.)

Timeline for d1fafa_: