SCOPe 2.08: Domain d1fafa_: 1faf A:

Lineage for d1fafa_ (1faf A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.3: Chaperone J-domain [46565] (2 families)

5. Family a.2.3.1: Chaperone J-domain [46566] (7 proteins)
   Pfam PF00226

6. Protein Large T antigen, the N-terminal J domain [46573] (2 species)

7. Species Murine polyomavirus [TaxId:10634] [46574] (1 PDB entry)

8. Domain d1fafa_: 1faf A: [15700]

Details for d1fafa_

PDB Entry: 1faf

PDB Description: nmr structure of the n-terminal j domain of murine polyomavirus t antigens.

PDB Compounds: (A:) large t antigen

SCOPe Domain Sequences for d1fafa_:

Sequence; same for both SEQRES and ATOM records:

>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]}
mdrvlsradkerllellklprqlwgdfgrmqqaykqqslllhpdkggshalmqelnslwg
tfktevynlrmnlggtgfq

Timeline for d1fafa_:

• d1fafa_ first appeared (with stable ids) in SCOP 1.55
  
• d1fafa_ appears in SCOPe 2.07