![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) ![]() |
![]() | Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (18 proteins) the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest C-terminal domains also show some similarity |
![]() | Protein Hydroxyisobutyrate dehydrogenase [102171] (3 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [159424] (1 PDB entry) Uniprot Q9I5I6 1-162 |
![]() | Domain d3cuma2: 3cum A:1-162 [156996] Other proteins in same PDB: d3cuma1 complexed with act, edo, peg |
PDB Entry: 3cum (more details), 2.2 Å
SCOP Domain Sequences for d3cuma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} mkqiafiglghmgapmatnllkagyllnvfdlvqsavdglvaagasaarsardavqgadv vismlpasqhveglyldddgllahiapgtlvlecstiaptsarkihaaarerglamldap vsggtagaaagtltfmvggdaealekarplfeamgrnifhag
Timeline for d3cuma2: