Lineage for d3cuma1 (3cum A:163-296)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 773947Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 773948Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (12 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 773949Family a.100.1.1: Hydroxyisobutyrate and 6-phosphogluconate dehydrogenase domain [48180] (2 proteins)
    Hydroxyisobutyrate dehydrogenase domain is similar to one structural repeat in the 6-phosphogluconate dehydrogenase domain
  6. 773960Protein Hydroxyisobutyrate dehydrogenase [101357] (3 species)
    forms similar dimeric and tetrameric structures to the 6-phosphogluconate dehydrogenase domain and its dimer, respectively
  7. 773961Species Pseudomonas aeruginosa [TaxId:287] [158733] (1 PDB entry)
    Uniprot Q9I5I6 163-296
  8. 773962Domain d3cuma1: 3cum A:163-296 [156995]
    Other proteins in same PDB: d3cuma2
    complexed with act, edo, peg

Details for d3cuma1

PDB Entry: 3cum (more details), 2.2 Å

PDB Description: Crystal structure of a possible 3-hydroxyisobutyrate dehydrogenase from Pseudomonas aeruginosa PAO1
PDB Compounds: (A:) Probable 3-hydroxyisobutyrate dehydrogenase

SCOP Domain Sequences for d3cuma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cuma1 a.100.1.1 (A:163-296) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]}
pdgagqvakvcnnqllavlmigtaeamalgvangleakvlaeimrrssggnwalevynpw
pgvmenapasrdysggfmaqlmakdlglaqeaaqasasstpmgslalslyrlllkqgyae
rdfsvvqklfdptq

SCOP Domain Coordinates for d3cuma1:

Click to download the PDB-style file with coordinates for d3cuma1.
(The format of our PDB-style files is described here.)

Timeline for d3cuma1:

  • d3cuma1 is new in SCOP 1.75
  • d3cuma1 does not appear in SCOPe 2.01

View in 3D
Domains from same chain:
(mouse over for more information)
d3cuma2