Lineage for d1bqz__ (1bqz -)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 350503Fold a.2: Long alpha-hairpin [46556] (12 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 350531Superfamily a.2.3: Chaperone J-domain [46565] (1 family) (S)
  5. 350532Family a.2.3.1: Chaperone J-domain [46566] (6 proteins)
  6. 350538Protein DnaJ chaperone, N-terminal (J) domain [46571] (1 species)
  7. 350539Species Escherichia coli [TaxId:562] [46572] (3 PDB entries)
  8. 350541Domain d1bqz__: 1bqz - [15699]

Details for d1bqz__

PDB Entry: 1bqz (more details)

PDB Description: j-domain (residues 1-77) of the escherichia coli n-terminal fragment (residues 1-78) of the molecular chaperone dnaj, nmr, 20 structures

SCOP Domain Sequences for d1bqz__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bqz__ a.2.3.1 (-) DnaJ chaperone, N-terminal (J) domain {Escherichia coli}
akqdyyeilgvsktaeereirkaykrlamkyhpdrnqgdkeaeakfkeikeayevltdsq
kraaydqyghaafeqgg

SCOP Domain Coordinates for d1bqz__:

Click to download the PDB-style file with coordinates for d1bqz__.
(The format of our PDB-style files is described here.)

Timeline for d1bqz__: