Lineage for d3ctha1 (3cth A:1054-1360)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 874255Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 874256Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 874317Family d.144.1.7: Protein kinases, catalytic subunit [88854] (63 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 874877Protein Hepatocyte growth factor receptor, c-MET [103300] (1 species)
    PTK group; HGFR subfamily; membrane spanning protein tyrosine kinase
  7. 874878Species Human (Homo sapiens) [TaxId:9606] [103301] (6 PDB entries)
  8. 874882Domain d3ctha1: 3cth A:1054-1360 [156983]
    automatically matched to d1r0pa_
    complexed with 319; mutant

Details for d3ctha1

PDB Entry: 3cth (more details), 2.3 Å

PDB Description: Crystal structure of the tyrosine kinase domain of the hepatocyte growth factor receptor c-met in complex with a aminopyridine based inhibitor
PDB Compounds: (A:) Hepatocyte growth factor receptor

SCOP Domain Sequences for d3ctha1:

Sequence, based on SEQRES records: (download)

>d3ctha1 d.144.1.7 (A:1054-1360) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]}
dlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcavksln
ritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirnet
hnptvkdligfglqvakgmkflaskkfvhrdlaarncmldekftvkvadfglardmydke
fdsvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfdit
vyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigehyvhvn
atyvnvk

Sequence, based on observed residues (ATOM records): (download)

>d3ctha1 d.144.1.7 (A:1054-1360) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]}
dlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcavksln
ritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirnet
hnptvkdligfglqvakgmkflaskkfvhrdlaarncmldekftvkvadfgnktgaklpv
kwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfditvyllqgrrllqpey
cpdplyevmlkcwhpkaemrpsfselvsrisaifstfigehyvhvnatyvnvk

SCOP Domain Coordinates for d3ctha1:

Click to download the PDB-style file with coordinates for d3ctha1.
(The format of our PDB-style files is described here.)

Timeline for d3ctha1: