Lineage for d3ctda1 (3ctd A:258-420)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2001760Fold a.80: post-AAA+ oligomerization domain-like [48018] (1 superfamily)
    core: 5 helices: bundle
  4. 2001761Superfamily a.80.1: post-AAA+ oligomerization domain-like [48019] (2 families) (S)
    associated with N-terminal domain from the AAA+ family of P-loop hydrolases
  5. 2001822Family a.80.1.2: MgsA/YrvN C-terminal domain-like [158600] (3 protein domains)
    automatically mapped to Pfam PF12002
  6. 2001849Protein Uncharacterized protein YrvN [158605] (1 species)
  7. 2001850Species Prochlorococcus marinus [TaxId:1219] [158606] (1 PDB entry)
    Uniprot Q7V3J8 258-420
    PMM0077
  8. 2001851Domain d3ctda1: 3ctd A:258-420 [156981]

Details for d3ctda1

PDB Entry: 3ctd (more details), 2.5 Å

PDB Description: crystal structure of a putative aaa family atpase from prochlorococcus marinus subsp. pastoris
PDB Compounds: (A:) Putative ATPase, AAA family

SCOPe Domain Sequences for d3ctda1:

Sequence, based on SEQRES records: (download)

>d3ctda1 a.80.1.2 (A:258-420) Uncharacterized protein YrvN {Prochlorococcus marinus [TaxId: 1219]}
nhfdvisafiksirgsdpdatlywlanmveagedpnfifrrllisacedigladpnaivv
vqsccdafdrvgfpeglfflsqaslylaispksnstksifkameaikatnvslvpnhlkn
nasnylnphnyqgkwlqqeylptdlqgikfwkpkdsgweknky

Sequence, based on observed residues (ATOM records): (download)

>d3ctda1 a.80.1.2 (A:258-420) Uncharacterized protein YrvN {Prochlorococcus marinus [TaxId: 1219]}
nhfdvisafiksirgsdpdatlywlanmveagedpnfifrrllisacedigladpnaivv
vqsccdafdrvgfpeglfflsqaslylaispksnstksifkameaiklvpnhlknnasny
lnphnylqqeylptdlikfwkpkgweknky

SCOPe Domain Coordinates for d3ctda1:

Click to download the PDB-style file with coordinates for d3ctda1.
(The format of our PDB-style files is described here.)

Timeline for d3ctda1:

View in 3D
Domains from other chains:
(mouse over for more information)
d3ctdb_