SCOPe 2.08: Domain d3csia1: 3csi A:79-209

Lineage for d3csia1 (3csi A:79-209)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class pi GST [81347] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47619] (67 PDB entries)

8. Domain d3csia1: 3csi A:79-209 [156965]
   Other proteins in same PDB: d3csia2, d3csib2, d3csic2, d3csid2
   automated match to d1gssa1
   complexed with ca, cl, co3, gsh, lz6, mes, so4

Details for d3csia1

PDB Entry: 3csi, 1.9 Å

PDB Description: crystal structure of the glutathione transferase pi allelic variant*c, i104v/a113v, in complex with the chlorambucil-glutathione conjugate

PDB Compounds: (A:) Glutathione S-transferase P

SCOPe Domain Sequences for d3csia1:

Sequence; same for both SEQRES and ATOM records:

>d3csia1 a.45.1.1 (A:79-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
ygkdqqeaalvdmvndgvedlrckyvsliytnyevgkddyvkalpgqlkpfetllsqnqg
gktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflaspey
vnlpingngkq

Timeline for d3csia1:

• d3csia1 first appeared in SCOP 1.75
  
• d3csia1 appears in SCOPe 2.07