Lineage for d3csha2 (3csh A:1-76)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1852841Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 1853156Protein Class pi GST [81358] (4 species)
  7. 1853157Species Human (Homo sapiens) [TaxId:9606] [52864] (49 PDB entries)
  8. 1853160Domain d3csha2: 3csh A:1-76 [156962]
    Other proteins in same PDB: d3csha1, d3cshb1
    automated match to d1aqwa2
    complexed with ca, cl, gsh, lz6, mes, so4

Details for d3csha2

PDB Entry: 3csh (more details), 1.55 Å

PDB Description: crystal structure of glutathione transferase pi in complex with the chlorambucil-glutathione conjugate
PDB Compounds: (A:) Glutathione S-transferase P

SCOPe Domain Sequences for d3csha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3csha2 c.47.1.5 (A:1-76) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
tlyqsntilrhlgrtl

SCOPe Domain Coordinates for d3csha2:

Click to download the PDB-style file with coordinates for d3csha2.
(The format of our PDB-style files is described here.)

Timeline for d3csha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3csha1