![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.1: Phosphate binding protein-like [53851] (40 proteins) |
![]() | Protein D-maltodextrin-binding protein, MBP [53862] (5 species) contains a few additional helices in the C-terminal extension; homologous to thiaminase I |
![]() | Species Escherichia coli K12 (Escherichia coli K-12) [TaxId:83333] [159806] (1 PDB entry) |
![]() | Domain d3csba2: 3csb A:5-370 [156960] Other proteins in same PDB: d3csba1 automatically matched to d1mpba_ complexed with 1pe, edo, mn, peg, pg4, pge |
PDB Entry: 3csb (more details), 2 Å
SCOP Domain Sequences for d3csba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3csba2 c.94.1.1 (A:5-370) D-maltodextrin-binding protein, MBP {Escherichia coli K12 (Escherichia coli K-12) [TaxId: 83333]} gklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdiifwah drfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkdllpn ppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikdvgvd nagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskvnygv tvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplgaval ksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdealkda qtritk
Timeline for d3csba2: