Lineage for d3cs6a1 (3cs6 A:119-423)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 776482Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 776483Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 776484Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (33 proteins)
  6. 777031Protein Vitamin D nuclear receptor [48528] (2 species)
  7. 777032Species Human (Homo sapiens) [TaxId:9606] [48529] (13 PDB entries)
  8. 777042Domain d3cs6a1: 3cs6 A:119-423 [156955]
    automatically matched to d1ie9a_
    complexed with 0co

Details for d3cs6a1

PDB Entry: 3cs6 (more details), 1.8 Å

PDB Description: Structure-based design of a superagonist ligand for the vitamin D nuclear receptor
PDB Compounds: (A:) Vitamin D3 receptor

SCOP Domain Sequences for d3cs6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cs6a1 a.123.1.1 (A:119-423) Vitamin D nuclear receptor {Human (Homo sapiens) [TaxId: 9606]}
slrpklseeqqriiailldahhktydptysdfcqfrppvrvndgggsvtlelsqlsmlph
ladlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtcg
nqdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrpgvqda
alieaiqdrlsntlqtyircrhpppgshllyakmiqkladlrslneehskqyrclsfqpe
csmkltplvlevfg

SCOP Domain Coordinates for d3cs6a1:

Click to download the PDB-style file with coordinates for d3cs6a1.
(The format of our PDB-style files is described here.)

Timeline for d3cs6a1: