Lineage for d3cs0a3 (3cs0 A:11-259)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055631Family b.47.1.1: Prokaryotic proteases [50495] (16 protein domains)
  6. 2055738Protein Protease Do (DegP, HtrA), catalytic domain [74969] (2 species)
  7. 2055739Species Escherichia coli [TaxId:562] [74970] (4 PDB entries)
  8. 2055740Domain d3cs0a3: 3cs0 A:11-259 [156953]
    Other proteins in same PDB: d3cs0a1, d3cs0a2
    automatically matched to d1ky9a2

Details for d3cs0a3

PDB Entry: 3cs0 (more details), 3 Å

PDB Description: Crystal structure of DegP24
PDB Compounds: (A:) Protease do

SCOPe Domain Sequences for d3cs0a3:

Sequence, based on SEQRES records: (download)

>d3cs0a3 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]}
qmpslapmlekvmpsvvsinvegsttvntprmprnfqqffgddspfcqegspfqsspfcq
ggqggngggqqqkfmalgsgviidadkgyvvtnnhvvdnatvikvqlsdgrkfdakmvgk
dprsdialiqiqnpknltaikmadsdalrvgdytvaignpfglgetvtsgivsalgrsgl
naenyenfiqtdaainrgnsggalvnlngeligintailapdggnigigfaipsnmvknl
tsqmveygq

Sequence, based on observed residues (ATOM records): (download)

>d3cs0a3 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]}
qmpslapmlekvmpsvvsinvegstqkfmalgsgviidadkgyvvtnnhvvdnatvikvq
lsdgrkfdakmvgkdprsdialiqiqnpknltaikmadsdalrvgdytvaignpfglget
vtsgivsalgrsglnaenyenfiqtdaainrgnsggalvnlngeligintailapdggni
gigfaipsnmvknltsqmveygq

SCOPe Domain Coordinates for d3cs0a3:

Click to download the PDB-style file with coordinates for d3cs0a3.
(The format of our PDB-style files is described here.)

Timeline for d3cs0a3: