![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.3: Bacterial adhesins [49401] (7 families) ![]() |
![]() | Family b.2.3.2: Pilus subunits [49405] (10 proteins) |
![]() | Protein SafA pilus subunit [141080] (1 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [141081] (4 PDB entries) Uniprot Q8ZRK4 36-168! Uniprot Q8ZRK4 46-170 |
![]() | Domain d3crfa1: 3crf A:22-142 [156948] automatically matched to d2co3a1 |
PDB Entry: 3crf (more details), 17 Å
SCOPe Domain Sequences for d3crfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3crfa1 b.2.3.2 (A:22-142) SafA pilus subunit {Salmonella typhimurium [TaxId: 90371]} dltvslipvsglkagknapsakiaklvvnsttlkefgvrgisnnvvdstgtawrvagknt gkeigvglssdslrrsdstekwngvnwmtfnsndtldivltgpaqnvtadtypitldvvg y
Timeline for d3crfa1: