SCOPe 2.06: Domain d3crfa1: 3crf A:22-142

Lineage for d3crfa1 (3crf A:22-142)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (10 proteins)

6. Protein SafA pilus subunit [141080] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [141081] (4 PDB entries)
   Uniprot Q8ZRK4 36-168! Uniprot Q8ZRK4 46-170

8. Domain d3crfa1: 3crf A:22-142 [156948]
   automatically matched to d2co3a1

Details for d3crfa1

PDB Entry: 3crf, 17 Å

PDB Description: electron microscopy model of the saf pilus- type b

PDB Compounds: (A:) Outer membrane protein

SCOPe Domain Sequences for d3crfa1:

Sequence; same for both SEQRES and ATOM records:

>d3crfa1 b.2.3.2 (A:22-142) SafA pilus subunit {Salmonella typhimurium [TaxId: 90371]}
dltvslipvsglkagknapsakiaklvvnsttlkefgvrgisnnvvdstgtawrvagknt
gkeigvglssdslrrsdstekwngvnwmtfnsndtldivltgpaqnvtadtypitldvvg
y

Timeline for d3crfa1:

• d3crfa1 first appeared in SCOP 1.75
  
• d3crfa1 appears in SCOPe 2.05
  
• d3crfa1 appears in SCOPe 2.07
  
• d3crfa1 appears in the current release, SCOPe 2.08