Lineage for d3crea1 (3cre A:22-142)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767438Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2767443Family b.2.3.2: Pilus subunits [49405] (11 proteins)
  6. 2767652Protein SafA pilus subunit [141080] (1 species)
  7. 2767653Species Salmonella typhimurium [TaxId:90371] [141081] (4 PDB entries)
    Uniprot Q8ZRK4 36-168! Uniprot Q8ZRK4 46-170
  8. 2767658Domain d3crea1: 3cre A:22-142 [156946]
    automatically matched to d2co3a1

Details for d3crea1

PDB Entry: 3cre (more details), 17 Å

PDB Description: electron microscopy model of the saf pilus- type a
PDB Compounds: (A:) Outer membrane protein

SCOPe Domain Sequences for d3crea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3crea1 b.2.3.2 (A:22-142) SafA pilus subunit {Salmonella typhimurium [TaxId: 90371]}
dltvslipvsglkagknapsakiaklvvnsttlkefgvrgisnnvvdstgtawrvagknt
gkeigvglssdslrrsdstekwngvnwmtfnsndtldivltgpaqnvtadtypitldvvg
y

SCOPe Domain Coordinates for d3crea1:

Click to download the PDB-style file with coordinates for d3crea1.
(The format of our PDB-style files is described here.)

Timeline for d3crea1: