Lineage for d3cr9a2 (3cr9 A:334-689)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2914985Family c.94.1.2: Transferrin [53888] (4 proteins)
    further duplication: composed of two two-domain lobes
  6. 2914986Protein Lactoferrin [53889] (6 species)
  7. 2915026Species Horse (Equus caballus) [TaxId:9796] [53893] (7 PDB entries)
  8. 2915034Domain d3cr9a2: 3cr9 A:334-689 [156944]
    automatically matched to d1b1xa2
    complexed with fe, glc

Details for d3cr9a2

PDB Entry: 3cr9 (more details), 3.49 Å

PDB Description: crystal structure of the complex of lactoferrin with 6- (hydroxymethyl)oxane-2,3,4,5-tetrol at 3.49 a resolution
PDB Compounds: (A:) lactotransferrin

SCOPe Domain Sequences for d3cr9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cr9a2 c.94.1.2 (A:334-689) Lactoferrin {Horse (Equus caballus) [TaxId: 9796]}
taaevaarrervvwcavgpeeerkckqwsdvsnrkvacasastteecialvlkgeadaln
ldggfiyvagkcglvpvlaenqksqnsnapdcvhrppegylavavvrksdadltwnslsg
kkschtgvgrtaawnipmgllfnqtgsckfdkffsqscapgadpqsslcalcvgnnenen
kcmpnseeryygytgafrclaekagdvafvkdvtvlqntdgknsepwakdlkqedfellc
ldgtrkpvaeaeschlarapnhavvsqsdraqhlkkvlflqqdqfggngpdcpgkfclfk
setknllfndnteclaelqgkttyeqylgseyvtsitnlrrcsssplleacaflra

SCOPe Domain Coordinates for d3cr9a2:

Click to download the PDB-style file with coordinates for d3cr9a2.
(The format of our PDB-style files is described here.)

Timeline for d3cr9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3cr9a1