![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.2: Transferrin [53888] (4 proteins) further duplication: composed of two two-domain lobes |
![]() | Protein Lactoferrin [53889] (6 species) |
![]() | Species Horse (Equus caballus) [TaxId:9796] [53893] (7 PDB entries) |
![]() | Domain d3cr9a1: 3cr9 A:1-333 [156943] automatically matched to d1b1xa1 complexed with fe, glc |
PDB Entry: 3cr9 (more details), 3.49 Å
SCOPe Domain Sequences for d3cr9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cr9a1 c.94.1.2 (A:1-333) Lactoferrin {Horse (Equus caballus) [TaxId: 9796]} aprksvrwctispaeaakcakfqrnmkkvrgpsvscirktssfeciqaiaankadavtld gglvyeaglhpyklrpvaaevyqtrgkpqtryyavavvkkgsgfqlnqlqgvkschtglg rsagwnipigtlrpylnwtgppeplqkavanffsascvpcadgkqypnlcrlcagteadk cacssqepyfgysgafkclengagdvafvkdstvfenlpdeaerdkyellcpdntrkpvd afkechlarvpshavvarsvdgredliwkllhraqeefgrnkssafqlfgstpgeqdllf kdsalgfvripsqidsglylganyltatqnlre
Timeline for d3cr9a1: