SCOP 1.75: Domain d3cr4x1: 3cr4 X:0-89

Lineage for d3cr4x1 (3cr4 X:0-89)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (11 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.2: S100 proteins [47478] (1 protein)
   dimer: subunits are made of two EF-hands

6. Protein Calcyclin (S100) [47479] (17 species)

7. Species Cow (Bos taurus), s100b [TaxId:9913] [47482] (6 PDB entries)

8. Domain d3cr4x1: 3cr4 X:0-89 [156941]
   automatically matched to d1cfpa_
   complexed with ca, pnt

Details for d3cr4x1

PDB Entry: 3cr4, 2.15 Å

PDB Description: x-ray structure of bovine pnt,ca(2+)-s100b

PDB Compounds: (X:) Protein S100-B

SCOP Domain Sequences for d3cr4x1:

Sequence; same for both SEQRES and ATOM records:

>d3cr4x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]}
mselekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldsdgdgecdfqefmafvamittacheffe

Timeline for d3cr4x1:

• d3cr4x1 is new in SCOP 1.75
  
• d3cr4x1 is called d3cr4x_ in SCOPe 2.01
  
• d3cr4x1 appears in the current release, SCOPe 2.08, called d3cr4x_