Lineage for d1fpob1 (1fpo B:1-76)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 350503Fold a.2: Long alpha-hairpin [46556] (12 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 350531Superfamily a.2.3: Chaperone J-domain [46565] (1 family) (S)
  5. 350532Family a.2.3.1: Chaperone J-domain [46566] (6 proteins)
  6. 350543Protein HSC20 (HSCB), N-terminal (J) domain [46567] (1 species)
  7. 350544Species Escherichia coli [TaxId:562] [46568] (1 PDB entry)
  8. 350546Domain d1fpob1: 1fpo B:1-76 [15694]
    Other proteins in same PDB: d1fpoa2, d1fpob2, d1fpoc2

Details for d1fpob1

PDB Entry: 1fpo (more details), 1.8 Å

PDB Description: hsc20 (hscb), a j-type co-chaperone from e. coli

SCOP Domain Sequences for d1fpob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fpob1 a.2.3.1 (B:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli}
mdyftlfglparyqldtqalslrfqdlqrqyhpdkfasgsqaeqlaavqqsatinqawqt
lrhplmraeyllslhg

SCOP Domain Coordinates for d1fpob1:

Click to download the PDB-style file with coordinates for d1fpob1.
(The format of our PDB-style files is described here.)

Timeline for d1fpob1: