SCOPe 2.08: Domain d3cr3c_: 3cr3 C:

Lineage for d3cr3c_ (3cr3 C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.54: PTS system fructose IIA component-like [53061] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest

4. Superfamily c.54.1: PTS system fructose IIA component-like [53062] (3 families)
   active dimer is formed by strand 5 swapping

5. Family c.54.1.2: DhaM-like [159618] (2 proteins)
   probable link between the PTS system fructose IIA component-like superfamily and the DAK1/DegV-like superfamily (82549)
   automatically mapped to Pfam PF03610

6. Protein PTS-dependent dihydroxyacetone kinase, phosphotransferase subunit DhaM [159621] (1 species)

7. Species Lactococcus lactis [TaxId:1358] [159622] (2 PDB entries)
   Uniprot Q9CIV6 1-123

8. Domain d3cr3c_: 3cr3 C: [156939]
   Other proteins in same PDB: d3cr3a1, d3cr3b_
   automated match to d3ct6a1
   complexed with adp, mg

Details for d3cr3c_

PDB Entry: 3cr3, 2.1 Å

PDB Description: Structure of a transient complex between Dha-kinase subunits DhaM and DhaL from Lactococcus lactis

PDB Compounds: (C:) PTS-dependent dihydroxyacetone kinase, phosphotransferase subunit dhaM

SCOPe Domain Sequences for d3cr3c_:

Sequence; same for both SEQRES and ATOM records:

>d3cr3c_ c.54.1.2 (C:) PTS-dependent dihydroxyacetone kinase, phosphotransferase subunit DhaM {Lactococcus lactis [TaxId: 1358]}
ygivivshspeiasglkklirevaknisltaigglengeigtsfdrvmnaieeneadnll
tffdlgsarmnldlvsemtdkeltifnvpliegaytasalleagatfeaikeqlekmlie
k

Timeline for d3cr3c_:

• d3cr3c_ first appeared in SCOP 1.75, called d3cr3c1
  
• d3cr3c_ appears in SCOPe 2.07