Lineage for d3cqzk_ (3cqz K:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1420028Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 1420151Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families) (S)
    form homo and heterodimers
  5. 1420250Family d.74.3.2: RBP11/RpoL [64311] (3 proteins)
  6. 1420285Protein automated matches [190337] (1 species)
    not a true protein
  7. 1420286Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187160] (2 PDB entries)
  8. 1420287Domain d3cqzk_: 3cqz K: [156934]
    Other proteins in same PDB: d3cqza1, d3cqzb_, d3cqzf1, d3cqzh_, d3cqzj_, d3cqzl1
    automated match to d1i3qk_
    protein/DNA complex; protein/RNA complex; complexed with zn

Details for d3cqzk_

PDB Entry: 3cqz (more details), 2.8 Å

PDB Description: Crystal structure of 10 subunit RNA polymerase II in complex with the inhibitor alpha-amanitin
PDB Compounds: (K:) DNA-directed RNA polymerase II subunit RPB11

SCOPe Domain Sequences for d3cqzk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cqzk_ d.74.3.2 (K:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
napdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaay
kvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtl

SCOPe Domain Coordinates for d3cqzk_:

Click to download the PDB-style file with coordinates for d3cqzk_.
(The format of our PDB-style files is described here.)

Timeline for d3cqzk_: