Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) form homo and heterodimers |
Family d.74.3.2: RBP11/RpoL [64311] (4 proteins) |
Protein automated matches [190337] (2 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187160] (5 PDB entries) |
Domain d3cqzk_: 3cqz K: [156934] Other proteins in same PDB: d3cqza1, d3cqzb_, d3cqzf1, d3cqzh_, d3cqzj_, d3cqzl1 automated match to d1i3qk_ protein/DNA complex; protein/RNA complex; complexed with zn |
PDB Entry: 3cqz (more details), 2.8 Å
SCOPe Domain Sequences for d3cqzk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cqzk_ d.74.3.2 (K:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} napdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaay kvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtl
Timeline for d3cqzk_: