Lineage for d3cqzb_ (3cqz B:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1954356Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 1954357Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 1954358Family e.29.1.1: RNA-polymerase beta [64485] (3 proteins)
  6. 1954411Protein automated matches [190192] (4 species)
    not a true protein
  7. 1954412Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187158] (5 PDB entries)
  8. 1954413Domain d3cqzb_: 3cqz B: [156930]
    Other proteins in same PDB: d3cqza1, d3cqzf1, d3cqzh_, d3cqzj_, d3cqzk_, d3cqzl1
    automated match to d1i50b_
    protein/DNA complex; protein/RNA complex; complexed with zn

Details for d3cqzb_

PDB Entry: 3cqz (more details), 2.8 Å

PDB Description: Crystal structure of 10 subunit RNA polymerase II in complex with the inhibitor alpha-amanitin
PDB Compounds: (B:) DNA-directed RNA polymerase II subunit RPB2

SCOPe Domain Sequences for d3cqzb_:

Sequence, based on SEQRES records: (download)

>d3cqzb_ e.29.1.1 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
desapitaedswavisaffrekglvsqqldsfnqfvdytlqdiicedstlileqlaqhtt
esdnisrkyeisfgkiyvtkpmvnesdgvthalypqearlrnltyssglfvdvkkrtyea
idvpgrelkyeliaeeseddsesgkvfigrlpimlrskncylseatesdlyklkecpfdm
ggyfiingsekvliaqersagnivqvfkkaapspishvaeirsalekgsrfistlqvkly
gregssartikatlpyikqdipiviifralgiipdgeilehicydvndwqmlemlkpcve
dgfviqdretaldfigrrgtalgikkekriqyakdilqkeflphitqlegfesrkafflg
yminrlllcaldrkdqddrdhfgkkrldlagpllaqlfktlfkkltkdifrymqrtveea
hdfnmklainaktitsglkyalatgnwgeqkkamssragvsqvlnrytysstlshlrrtn
tpigrdgklakprqlhnthwglvcpaetpegqacglvknlslmscisvgtdpmpiitfls
ewgmepledyvphqspdatrvfvngvwhgvhrnparlmetlrtlrrkgdinpevsmirdi
rekelkiftdagrvyrplfiveddeslghkelkvrkghiaklmateyqdieggfedveey
twssllneglveyidaeeeesiliamqpedlepaeaneendldvdpakrirvshhattft
hceihpsmilgvaasiipfpdhnqsprntyqsamgkqamgvfltnynvrmdtmanilyyp
qkplgttrameylkfrelpagqnaivaiacysgynqedsmimnqssidrglfrslffrsy
mdqekkygmsitetfekpqrtntlrmkhgtydkldddgliapgvrvsgedviigkttpis
pdeeelgqrtayhskrdastplrstengivdqvlvttnqdglkfvkvrvrttkipqigdk
fasrhgqkgtigityrredmpftaegivpdliinphaipsrmtvahliecllskvaalsg
negdaspftditvegiskllrehgyqsrgfevmynghtgkklmaqiffgptyyqrlrhmv
ddkiharargpmqvltrqpvegrsrdgglrfgemerdcmiahgaasflkerlmeasdafr
vhicgicglmtviaklnhnqfeckgcdnkidiyqihipyaakllfqelmamnitprlytd
rs

Sequence, based on observed residues (ATOM records): (download)

>d3cqzb_ e.29.1.1 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
desapitaedswavisaffrekglvsqqldsfnqfvdytlqdiicedstleisfgkiyvt
kpmvnesdgvthalypqearlrnltyssglfvdvkkesgkvfigrlpimlrskncylsea
tesdlyklkecpfdmggyfiingsekvliaqersagnivqvfkkaapspishvaeirsal
ekgistlqvklygregssartikatlpyikqdipiviifralgiipdgeilehicydvnd
wqmlemlkpcvedgfviqdretaldfigrrgtalgikkekriqyakdilqkeflphitql
egfesrkafflgyminrlllcaldrkdqddrdhfgkkrldlagpllaqlfktlfkkltkd
ifrlainaktitsglkyalatgnwagvsqvlnrytysstlshlrrtntpigrdgklakpr
qlhnthwglvcpaetpegqacglvknlslmscisvgtdpmpiitflsewgmepledyvph
qspdatrvfvngvwhgvhrnparlmetlrtlrrkgdinpevsmirdirekelkiftdagr
vyrplfiveddeslghkelkvrkghiaklmateyqdveeytwssllneglveyidaeeee
siliamqpedlepdvdpakrirvshhattfthceihpsmilgvaasiipfpdhnqsprnt
yqsamgkqamgvfltnynvrmdtmanilyypqkplgttrameylkfrelpagqnaivaia
cysgynqedsmimnqssidrglfrslffrsymdqekkitetfekpqrtrmkhgtydkldd
dgliapgvrvsgedviigkttpskrdastplrstengivdqvlvttnqdglkfvkvrvrt
tkipqigdkfasrhgqkgtigityrredmpftaegivpdliinphaipsrmtvahliecl
lskvaalsgnegdaspftditvegiskllrehgyqsrgfevmynghtgkklmaqiffgpt
yyqrlrhmvglrfgemerdcmiahgaasflkerlmeasdafrvhicgicglmtviahnqf
eckgcdnkidiyqihipyaakllfqelmamnitprlytdrs

SCOPe Domain Coordinates for d3cqzb_:

Click to download the PDB-style file with coordinates for d3cqzb_.
(The format of our PDB-style files is described here.)

Timeline for d3cqzb_: