Lineage for d3cpwz1 (3cpw Z:1-56)

  1. Root: SCOPe 2.07
  2. 2647132Class i: Low resolution protein structures [58117] (25 folds)
  3. 2647133Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2647134Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2648151Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 2648286Protein Prokaryotic (50S subunit) [58125] (3 species)
  7. 2648433Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 2648518Domain d3cpwz1: 3cpw Z:1-56 [156926]
    Other proteins in same PDB: d3cpw11, d3cpwb1, d3cpwf1, d3cpwh1, d3cpwo1, d3cpwq1, d3cpwr1, d3cpwx1, d3cpwy1
    automatically matched to d1w2bz_
    protein/RNA complex; complexed with ace, cd, cl, k, mg, na, sr, zld

Details for d3cpwz1

PDB Entry: 3cpw (more details), 2.7 Å

PDB Description: the structure of the antibiotic linezolid bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (Z:) 50S ribosomal protein L37e

SCOPe Domain Sequences for d3cpwz1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cpwz1 i.1.1.2 (Z:1-56) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]}
tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage

SCOPe Domain Coordinates for d3cpwz1:

Click to download the PDB-style file with coordinates for d3cpwz1.
(The format of our PDB-style files is described here.)

Timeline for d3cpwz1: