Lineage for d3cpwx1 (3cpw X:95-236)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1155945Fold c.9: Barstar-like [52037] (2 superfamilies)
    2 layers, a/b; parallel beta-sheet of 3 strands, order 123
  4. 1156000Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family) (S)
  5. 1156001Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein)
    contains irregular N-terminal extension to the common fold
  6. 1156002Protein Ribosomal protein L32e [52044] (1 species)
  7. 1156003Species Haloarcula marismortui [TaxId:2238] [52045] (58 PDB entries)
    Uniprot P12736
  8. 1156027Domain d3cpwx1: 3cpw X:95-236 [156924]
    Other proteins in same PDB: d3cpw11, d3cpw21, d3cpwb1, d3cpwd1, d3cpwf1, d3cpwh1, d3cpwi1, d3cpwj1, d3cpwk1, d3cpwm1, d3cpwn1, d3cpwo1, d3cpwp1, d3cpwq1, d3cpwr1, d3cpws1, d3cpwt1, d3cpwu1, d3cpwv1, d3cpww1, d3cpwy1, d3cpwz1
    automatically matched to d1jj2x_
    protein/RNA complex; complexed with ace, cd, cl, k, mg, na, sr, zld

Details for d3cpwx1

PDB Entry: 3cpw (more details), 2.7 Å

PDB Description: the structure of the antibiotic linezolid bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (X:) 50S ribosomal protein L32e

SCOPe Domain Sequences for d3cpwx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cpwx1 c.9.2.1 (X:95-236) Ribosomal protein L32e {Haloarcula marismortui [TaxId: 2238]}
telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr
rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr
erieeeaedagirvlnptyvev

SCOPe Domain Coordinates for d3cpwx1:

Click to download the PDB-style file with coordinates for d3cpwx1.
(The format of our PDB-style files is described here.)

Timeline for d3cpwx1: