Class a: All alpha proteins [46456] (284 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) |
Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein) |
Protein Ribosomal protein L29 (L29p) [46563] (5 species) |
Species Haloarcula marismortui [TaxId:2238] [46564] (40 PDB entries) Uniprot P10971 |
Domain d1ffks_: 1ffk S: [15692] Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkb_, d1ffkc_, d1ffkd_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffky_, d1ffkz_ complexed with cd, k, mg |
PDB Entry: 1ffk (more details), 2.4 Å
SCOPe Domain Sequences for d1ffks_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ffks_ a.2.2.1 (S:) Ribosomal protein L29 (L29p) {Haloarcula marismortui [TaxId: 2238]} tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq geegd
Timeline for d1ffks_:
View in 3D Domains from other chains: (mouse over for more information) d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkb_, d1ffkc_, d1ffkd_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffky_, d1ffkz_ |