Lineage for d1ffks_ (1ffk S:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 904111Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 904128Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) (S)
  5. 904129Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)
  6. 904130Protein Ribosomal protein L29 (L29p) [46563] (5 species)
  7. 904171Species Haloarcula marismortui [TaxId:2238] [46564] (44 PDB entries)
    Uniprot P10971
  8. 904211Domain d1ffks_: 1ffk S: [15692]
    Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkb_, d1ffkc_, d1ffkd_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffky_, d1ffkz_
    complexed with cd, k, mg

Details for d1ffks_

PDB Entry: 1ffk (more details), 2.4 Å

PDB Description: crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution
PDB Compounds: (S:) ribosomal protein l29

SCOPe Domain Sequences for d1ffks_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffks_ a.2.2.1 (S:) Ribosomal protein L29 (L29p) {Haloarcula marismortui [TaxId: 2238]}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd

SCOPe Domain Coordinates for d1ffks_:

Click to download the PDB-style file with coordinates for d1ffks_.
(The format of our PDB-style files is described here.)

Timeline for d1ffks_: