Lineage for d1ffks_ (1ffk S:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 276870Fold a.2: Long alpha-hairpin [46556] (11 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 276876Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) (S)
  5. 276877Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)
  6. 276878Protein Ribosomal protein L29 (L29p) [46563] (1 species)
  7. 276879Species Archaeon Haloarcula marismortui [TaxId:2238] [46564] (12 PDB entries)
  8. 276884Domain d1ffks_: 1ffk S: [15692]
    Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkc_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffkz_
    complexed with cd, k, mo3; mutant

Details for d1ffks_

PDB Entry: 1ffk (more details), 2.4 Å

PDB Description: crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution

SCOP Domain Sequences for d1ffks_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffks_ a.2.2.1 (S:) Ribosomal protein L29 (L29p) {Archaeon Haloarcula marismortui}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd

SCOP Domain Coordinates for d1ffks_:

Click to download the PDB-style file with coordinates for d1ffks_.
(The format of our PDB-style files is described here.)

Timeline for d1ffks_: