Lineage for d3cpws1 (3cpw S:1-119)

  1. Root: SCOPe 2.04
  2. 1710350Class i: Low resolution protein structures [58117] (25 folds)
  3. 1710351Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1710352Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1711204Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 1711205Protein 50S subunit [58125] (6 species)
  7. 1711354Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 1711449Domain d3cpws1: 3cpw S:1-119 [156919]
    Other proteins in same PDB: d3cpw11, d3cpwb1, d3cpwf1, d3cpwh1, d3cpwo1, d3cpwq1, d3cpwr1, d3cpwx1, d3cpwy1
    automatically matched to d1w2bs_
    protein/RNA complex; complexed with ace, cd, cl, k, mg, na, sr, zld

Details for d3cpws1

PDB Entry: 3cpw (more details), 2.7 Å

PDB Description: the structure of the antibiotic linezolid bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (S:) 50S ribosomal protein L24P

SCOPe Domain Sequences for d3cpws1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cpws1 i.1.1.2 (S:1-119) 50S subunit {Haloarcula marismortui [TaxId: 2238]}
skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg
evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa

SCOPe Domain Coordinates for d3cpws1:

Click to download the PDB-style file with coordinates for d3cpws1.
(The format of our PDB-style files is described here.)

Timeline for d3cpws1: