SCOPe 2.07: Domain d3cpwr1: 3cpw R:1-81

Lineage for d3cpwr1 (3cpw R:1-81)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
   beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243

4. Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families)

5. Family d.12.1.1: L23p [54190] (1 protein)
   automatically mapped to Pfam PF00276

6. Protein Ribosomal protein L23 [54191] (4 species)

7. Species Haloarcula marismortui [TaxId:2238] [54192] (58 PDB entries)
   Uniprot P12732

8. Domain d3cpwr1: 3cpw R:1-81 [156918]
   Other proteins in same PDB: d3cpw11, d3cpw21, d3cpwb1, d3cpwd1, d3cpwf1, d3cpwh1, d3cpwi1, d3cpwj1, d3cpwk1, d3cpwm1, d3cpwn1, d3cpwo1, d3cpwp1, d3cpwq1, d3cpws1, d3cpwt1, d3cpwu1, d3cpwv1, d3cpww1, d3cpwx1, d3cpwy1, d3cpwz1
   automatically matched to d1jj2r_
   protein/RNA complex; complexed with ace, cd, cl, k, mg, na, sr, zld

Details for d3cpwr1

PDB Entry: 3cpw, 2.7 Å

PDB Description: the structure of the antibiotic linezolid bound to the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (R:) 50S ribosomal protein L23P

SCOPe Domain Sequences for d3cpwr1:

Sequence; same for both SEQRES and ATOM records:

>d3cpwr1 d.12.1.1 (R:1-81) Ribosomal protein L23 {Haloarcula marismortui [TaxId: 2238]}
swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
ekkavvrlsedddaqevasri

Timeline for d3cpwr1:

• d3cpwr1 first appeared in SCOP 1.75
  
• d3cpwr1 appears in SCOPe 2.06
  
• d3cpwr1 appears in the current release, SCOPe 2.08