Lineage for d1grja1 (1grj A:2-79)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1256372Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1256373Superfamily a.2.1: GreA transcript cleavage protein, N-terminal domain [46557] (2 families) (S)
    automatically mapped to Pfam PF03449
  5. 1256374Family a.2.1.1: GreA transcript cleavage protein, N-terminal domain [46558] (1 protein)
  6. 1256375Protein GreA transcript cleavage protein, N-terminal domain [46559] (3 species)
    C-terminal domain is FKBP-like
  7. 1256376Species Escherichia coli [TaxId:562] [46560] (1 PDB entry)
  8. 1256377Domain d1grja1: 1grj A:2-79 [15691]
    Other proteins in same PDB: d1grja2

Details for d1grja1

PDB Entry: 1grj (more details), 2.2 Å

PDB Description: grea transcript cleavage factor from escherichia coli
PDB Compounds: (A:) grea protein

SCOPe Domain Sequences for d1grja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1grja1 a.2.1.1 (A:2-79) GreA transcript cleavage protein, N-terminal domain {Escherichia coli [TaxId: 562]}
qaipmtlrgaeklreeldflksvrrpeiiaaiaearehgdlkenaeyhaareqqgfcegr
ikdieaklsnaqvidvtk

SCOPe Domain Coordinates for d1grja1:

Click to download the PDB-style file with coordinates for d1grja1.
(The format of our PDB-style files is described here.)

Timeline for d1grja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1grja2