SCOPe 2.03: Domain d1grja1: 1grj A:2-79

Lineage for d1grja1 (1grj A:2-79)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.1: GreA transcript cleavage protein, N-terminal domain [46557] (2 families)
   automatically mapped to Pfam PF03449

5. Family a.2.1.1: GreA transcript cleavage protein, N-terminal domain [46558] (1 protein)

6. Protein GreA transcript cleavage protein, N-terminal domain [46559] (3 species)
   C-terminal domain is FKBP-like

7. Species Escherichia coli [TaxId:562] [46560] (1 PDB entry)

8. Domain d1grja1: 1grj A:2-79 [15691]
   Other proteins in same PDB: d1grja2

Details for d1grja1

PDB Entry: 1grj, 2.2 Å

PDB Description: grea transcript cleavage factor from escherichia coli

PDB Compounds: (A:) grea protein

SCOPe Domain Sequences for d1grja1:

Sequence; same for both SEQRES and ATOM records:

>d1grja1 a.2.1.1 (A:2-79) GreA transcript cleavage protein, N-terminal domain {Escherichia coli [TaxId: 562]}
qaipmtlrgaeklreeldflksvrrpeiiaaiaearehgdlkenaeyhaareqqgfcegr
ikdieaklsnaqvidvtk

Timeline for d1grja1:

• d1grja1 first appeared (with stable ids) in SCOP 1.55, called d1grj_1
  
• d1grja1 appears in SCOPe 2.02
  
• d1grja1 appears in SCOPe 2.04
  
• d1grja1 appears in the current release, SCOPe 2.08