Lineage for d1grj_1 (1grj 2-79)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) 
Fold a.2: Long alpha-hairpin [46556] (11 superfamilies) 
Superfamily a.2.1: GreA transcript cleavage protein, N-terminal domain [46557] (1 family) 
Family a.2.1.1: GreA transcript cleavage protein, N-terminal domain [46558] (1 protein) Protein GreA transcript cleavage protein, N-terminal domain [46559] (1 species) Species Escherichia coli [TaxId:562] [46560] (1 PDB entry) 
Domain d1grj_1: 1grj 2-79 [15691]
Other proteins in same PDB: d1grj_2
Details for d1grj_1
PDB Entry: 1grj (more details), 2.2 Å
PDB Description: grea transcript cleavage factor from escherichia coli
SCOP Domain Sequences for d1grj_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1grj_1 a.2.1.1 (2-79) GreA transcript cleavage protein, N-terminal domain {Escherichia coli}
qaipmtlrgaeklreeldflksvrrpeiiaaiaearehgdlkenaeyhaareqqgfcegr
ikdieaklsnaqvidvtk
SCOP Domain Coordinates for d1grj_1:
Click to download the PDB-style file with coordinates for d1grj_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1grj_1:
- d1grj_1 first appeared (with stable ids) in SCOP 1.55
- d1grj_1 appears in SCOP 1.59
- d1grj_1 appears in SCOP 1.63
- d1grj_1 appears in the current release, SCOPe 2.08, called d1grja1
View in 3D
