Lineage for d1grj_1 (1grj 2-79)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 811Fold a.2: Long alpha-hairpin [46556] (11 superfamilies)
  4. 812Superfamily a.2.1: GreA transcript cleavage protein, N-terminal domain [46557] (1 family) (S)
  5. 813Family a.2.1.1: GreA transcript cleavage protein, N-terminal domain [46558] (1 protein)
  6. 814Protein GreA transcript cleavage protein, N-terminal domain [46559] (1 species)
  7. 815Species Escherichia coli [TaxId:562] [46560] (1 PDB entry)
  8. 816Domain d1grj_1: 1grj 2-79 [15691]
    Other proteins in same PDB: d1grj_2

Details for d1grj_1

PDB Entry: 1grj (more details), 2.2 Å

PDB Description: grea transcript cleavage factor from escherichia coli

SCOP Domain Sequences for d1grj_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1grj_1 a.2.1.1 (2-79) GreA transcript cleavage protein, N-terminal domain {Escherichia coli}
qaipmtlrgaeklreeldflksvrrpeiiaaiaearehgdlkenaeyhaareqqgfcegr
ikdieaklsnaqvidvtk

SCOP Domain Coordinates for d1grj_1:

Click to download the PDB-style file with coordinates for d1grj_1.
(The format of our PDB-style files is described here.)

Timeline for d1grj_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1grj_2