Lineage for d3cpwf1 (3cpw F:1-119)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565345Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2566728Superfamily d.79.3: L30e-like [55315] (4 families) (S)
  5. 2566729Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)
  6. 2566746Protein Ribosomal protein L7ae [55319] (7 species)
  7. 2566754Species Haloarcula marismortui [TaxId:2238] [55320] (58 PDB entries)
    Uniprot P12743
  8. 2566794Domain d3cpwf1: 3cpw F:1-119 [156908]
    Other proteins in same PDB: d3cpw11, d3cpw21, d3cpwb1, d3cpwd1, d3cpwh1, d3cpwi1, d3cpwj1, d3cpwk1, d3cpwm1, d3cpwn1, d3cpwo1, d3cpwp1, d3cpwq1, d3cpwr1, d3cpws1, d3cpwt1, d3cpwu1, d3cpwv1, d3cpww1, d3cpwx1, d3cpwy1, d3cpwz1
    automatically matched to d1s72f_
    protein/RNA complex; complexed with ace, cd, cl, k, mg, na, sr, zld

Details for d3cpwf1

PDB Entry: 3cpw (more details), 2.7 Å

PDB Description: the structure of the antibiotic linezolid bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (F:) 50S ribosomal protein L7Ae

SCOPe Domain Sequences for d3cpwf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cpwf1 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Haloarcula marismortui [TaxId: 2238]}
pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv
mhipeladekgvpfifveqqddlghaaglevgsaaaavtdageadadvediadkveelr

SCOPe Domain Coordinates for d3cpwf1:

Click to download the PDB-style file with coordinates for d3cpwf1.
(The format of our PDB-style files is described here.)

Timeline for d3cpwf1: