Lineage for d3cpwd1 (3cpw D:10-174)

  1. Root: SCOPe 2.06
  2. 2268314Class i: Low resolution protein structures [58117] (25 folds)
  3. 2268315Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2268316Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2269333Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 2269468Protein Prokaryotic (50S subunit) [58125] (3 species)
  7. 2269615Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 2269757Domain d3cpwd1: 3cpw D:10-174 [156907]
    Other proteins in same PDB: d3cpw11, d3cpwb1, d3cpwf1, d3cpwh1, d3cpwo1, d3cpwq1, d3cpwr1, d3cpwx1, d3cpwy1
    automatically matched to d1w2bd_
    protein/RNA complex; complexed with ace, cd, cl, k, mg, na, sr, zld

Details for d3cpwd1

PDB Entry: 3cpw (more details), 2.7 Å

PDB Description: the structure of the antibiotic linezolid bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (D:) 50S ribosomal protein L5P

SCOPe Domain Sequences for d3cpwd1:

Sequence, based on SEQRES records: (download)

>d3cpwd1 i.1.1.2 (D:10-174) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]}
fhemrepriekvvvhmgighggrdlanaedilgeitgqmpvrtkakrtvgefdiregdpi
gakvtlrdemaeeflqtalplaelatsqfddtgnfsfgveehtefpsqeydpsigiygld
vtvnlvrpgyrvakrdkasrsiptkhrlnpadavafiestydvev

Sequence, based on observed residues (ATOM records): (download)

>d3cpwd1 i.1.1.2 (D:10-174) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]}
fhemrepriekvvvhmgighanaedilgeitgqmpvrtkakrtvgefdiregdpigakvt
lrdemaeeflqtalplaelatsqfddtgnfsfgldvtvnlvrpgyrvakrdkasrsiptk
hrlnpadavafiestydvev

SCOPe Domain Coordinates for d3cpwd1:

Click to download the PDB-style file with coordinates for d3cpwd1.
(The format of our PDB-style files is described here.)

Timeline for d3cpwd1: