Class a: All alpha proteins [46456] (289 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold |
Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family) interrupted alpha-helix automatically mapped to Pfam PF00832 |
Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein) |
Protein Ribosomal protein L39e [48664] (1 species) |
Species Haloarcula marismortui [TaxId:2238] [48665] (58 PDB entries) Uniprot P22452 |
Domain d3cpw11: 3cpw 1:1-49 [156904] Other proteins in same PDB: d3cpw21, d3cpwb1, d3cpwd1, d3cpwf1, d3cpwh1, d3cpwi1, d3cpwj1, d3cpwk1, d3cpwm1, d3cpwn1, d3cpwo1, d3cpwp1, d3cpwq1, d3cpwr1, d3cpws1, d3cpwt1, d3cpwu1, d3cpwv1, d3cpww1, d3cpwx1, d3cpwy1, d3cpwz1 automatically matched to 1VQ4 2:1-49 protein/RNA complex; complexed with ace, cd, cl, k, mg, na, sr, zld |
PDB Entry: 3cpw (more details), 2.7 Å
SCOPe Domain Sequences for d3cpw11:
Sequence, based on SEQRES records: (download)
>d3cpw11 a.137.1.1 (1:1-49) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]} gkkskatkkrlakldnqnsrvpawvmlktdrevqrnhkrrhwrrndtde
>d3cpw11 a.137.1.1 (1:1-49) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]} gkkskatkkrlakldnqnsrvpawvmlktdrrnhkrrhwrrndtde
Timeline for d3cpw11: