SCOPe 2.07: Domain d3cpjg3: 3cpj G:302-399

Lineage for d3cpjg3 (3cpj G:302-399)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.0: automated matches [254286] (1 protein)
   not a true family
6. Protein automated matches [254668] (1 species)
   not a true protein
7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255775] (3 PDB entries)

8. Domain d3cpjg3: 3cpj G:302-399 [156901]
   Other proteins in same PDB: d3cpjg1, d3cpjg2
   automated match to d2bcgg3
   complexed with cl, gdp, mg

Details for d3cpjg3

PDB Entry: 3cpj, 2.35 Å

PDB Description: crystal structure of ypt31 in complex with yeast rab-gdi

PDB Compounds: (G:) Rab GDP-dissociation inhibitor

SCOPe Domain Sequences for d3cpjg3:

Sequence; same for both SEQRES and ATOM records:

>d3cpjg3 d.16.1.0 (G:302-399) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kstgqrviraicilnhpvpntsnadslqiiipqsqlgrksdiyvaivsdahnvcskghyl
aiistiietdkphielepafkllgpieekfmgiaelfe

Timeline for d3cpjg3:

• d3cpjg3 first appeared in SCOP 1.75
  
• d3cpjg3 appears in SCOPe 2.06
  
• d3cpjg3 appears in the current release, SCOPe 2.08