| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) ![]() N-terminal domain is beta/beta/alpha common fold |
| Domain d3cpjg3: 3cpj G:302-399 [156901] Other proteins in same PDB: d3cpjg1, d3cpjg2 automated match to d2bcgg3 complexed with cl, gdp, mg |
PDB Entry: 3cpj (more details), 2.35 Å
SCOPe Domain Sequences for d3cpjg3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cpjg3 d.16.1.0 (G:302-399) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kstgqrviraicilnhpvpntsnadslqiiipqsqlgrksdiyvaivsdahnvcskghyl
aiistiietdkphielepafkllgpieekfmgiaelfe
Timeline for d3cpjg3: