Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) contains two Fe4-S4 clusters |
Family a.1.2.2: Dihydropyrimidine dehydrogenase, N-terminal domain [46553] (1 protein) |
Protein Dihydropyrimidine dehydrogenase, N-terminal domain [46554] (1 species) includes the N-terminal tail and the linker to domain 2 |
Species Pig (Sus scrofa) [TaxId:9823] [46555] (5 PDB entries) |
Domain d1h7xd1: 1h7x D:2-183 [15690] Other proteins in same PDB: d1h7xa2, d1h7xa3, d1h7xa4, d1h7xa5, d1h7xb2, d1h7xb3, d1h7xb4, d1h7xb5, d1h7xc2, d1h7xc3, d1h7xc4, d1h7xc5, d1h7xd2, d1h7xd3, d1h7xd4, d1h7xd5 complexed with fad, fmn, ndp, sf4, urf; mutant |
PDB Entry: 1h7x (more details), 2.01 Å
SCOPe Domain Sequences for d1h7xd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h7xd1 a.1.2.2 (D:2-183) Dihydropyrimidine dehydrogenase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} apvlskdvadiesilalnprtqshaalhstlakkldkkhwkrnpdkncfhceklennfdd ikhttlgergalreamrclkcadapcqkscpthldiksfitsisnknyygaakmifsdnp lgltcgmvcptsdlcvggcnlyateegsinigglqqfasevfkamnipqirnpclpsqek mp
Timeline for d1h7xd1:
View in 3D Domains from same chain: (mouse over for more information) d1h7xd2, d1h7xd3, d1h7xd4, d1h7xd5 |