Lineage for d3cpih2 (3cpi H:400-443)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1832628Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 1832629Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. Family c.3.1.0: automated matches [254287] (1 protein)
    not a true family
  6. Protein automated matches [254669] (1 species)
    not a true protein
  7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255776] (3 PDB entries)
  8. 1833523Domain d3cpih2: 3cpi H:400-443 [156897]
    Other proteins in same PDB: d3cpig1, d3cpig3, d3cpih1, d3cpih3
    automated match to d2bcgg2

Details for d3cpih2

PDB Entry: 3cpi (more details), 2.3 Å

PDB Description: crystal structure of yeast rab-gdi
PDB Compounds: (H:) Rab GDP-dissociation inhibitor

SCOPe Domain Sequences for d3cpih2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cpih2 c.3.1.0 (H:400-443) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
predgskdniylsrsydasshfesmtddvkdiyfrvtghplvlk

SCOPe Domain Coordinates for d3cpih2:

Click to download the PDB-style file with coordinates for d3cpih2.
(The format of our PDB-style files is described here.)

Timeline for d3cpih2: