SCOPe 2.08: Domain d3cpih1: 3cpi H:5-301

Lineage for d3cpih1 (3cpi H:5-301)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families)

5. Family c.3.1.3: GDI-like N domain [51931] (3 proteins)
   Similar to FAD-linked reductases in both domains but does not bind FAD

6. Protein automated matches [254667] (1 species)
   not a true protein
7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255774] (3 PDB entries)

8. Domain d3cpih1: 3cpi H:5-301 [156896]
   Other proteins in same PDB: d3cpig2, d3cpig3, d3cpih2, d3cpih3
   automated match to d2bcgg1

Details for d3cpih1

PDB Entry: 3cpi, 2.3 Å

PDB Description: crystal structure of yeast rab-gdi

PDB Compounds: (H:) Rab GDP-dissociation inhibitor

SCOPe Domain Sequences for d3cpih1:

Sequence; same for both SEQRES and ATOM records:

>d3cpih1 c.3.1.3 (H:5-301) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tidtdydvivlgtgitecilsgllsvdgkkvlhidkqdhyggeaasvtlsqlyekfkqnp
iskeereskfgkdrdwnvdlipkflmangeltnilihtdvtryvdfkqvsgsyvfkqgki
ykvpaneieaissplmgifekrrmkkflewissykeddlsthqgldldkntmdevyykfg
lgnstkefighamalwtnddylqqparpsferillycqsvarygkspylypmyglgelpq
gfarlsaiyggtymldtpidevlykkdtgkfegvktklgtfkaplviadptyfpekc

Timeline for d3cpih1:

• d3cpih1 first appeared in SCOP 1.75
  
• d3cpih1 appears in SCOPe 2.07