SCOPe 2.08: Domain d3cpig2: 3cpi G:400-443

Lineage for d3cpig2 (3cpi G:400-443)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families)

5. Family c.3.1.0: automated matches [254287] (1 protein)
   not a true family
6. Protein automated matches [254669] (1 species)
   not a true protein
7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255776] (3 PDB entries)

8. Domain d3cpig2: 3cpi G:400-443 [156894]
   Other proteins in same PDB: d3cpig1, d3cpig3, d3cpih1, d3cpih3
   automated match to d2bcgg2

Details for d3cpig2

PDB Entry: 3cpi, 2.3 Å

PDB Description: crystal structure of yeast rab-gdi

PDB Compounds: (G:) Rab GDP-dissociation inhibitor

SCOPe Domain Sequences for d3cpig2:

Sequence; same for both SEQRES and ATOM records:

>d3cpig2 c.3.1.0 (G:400-443) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
predgskdniylsrsydasshfesmtddvkdiyfrvtghplvlk

Timeline for d3cpig2:

• d3cpig2 first appeared in SCOP 1.75
  
• d3cpig2 appears in SCOPe 2.07