![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
![]() | Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) ![]() |
![]() | Domain d3cphh2: 3cph H:400-442 [156891] Other proteins in same PDB: d3cpha_, d3cphg1, d3cphg3, d3cphh1, d3cphh3 automated match to d2bcgg2 complexed with gdp, mg |
PDB Entry: 3cph (more details), 2.9 Å
SCOPe Domain Sequences for d3cphh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cphh2 c.3.1.0 (H:400-442) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} predgskdniylsrsydasshfesmtddvkdiyfrvtghplvl
Timeline for d3cphh2:
![]() Domains from other chains: (mouse over for more information) d3cpha_, d3cphg1, d3cphg2, d3cphg3 |