Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) |
Family c.3.1.3: GDI-like N domain [51931] (3 proteins) Similar to FAD-linked reductases in both domains but does not bind FAD |
Domain d3cphh1: 3cph H:7-301 [156890] Other proteins in same PDB: d3cpha_, d3cphg2, d3cphg3, d3cphh2, d3cphh3 automated match to d2bcgg1 complexed with gdp, mg |
PDB Entry: 3cph (more details), 2.9 Å
SCOPe Domain Sequences for d3cphh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cphh1 c.3.1.3 (H:7-301) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} dtdydvivlgtgitecilsgllsvdgkkvlhidkqdhyggeaasvtlsqlyekfkqnpis keereskfgkdrdwnvdlipkflmangeltnilihtdvtryvdfkqvsgsyvfkqgkiyk vpaneieaissplmgifekrrmkkflewissykeddlsthqgldldkntmdevyykfglg nstkefighamalwtnddylqqparpsferillycqsvarygkspylypmyglgelpqgf arlsaiyggtymldtpidevlykkdtgkfegvktklgtfkaplviadptyfpekc
Timeline for d3cphh1:
View in 3D Domains from other chains: (mouse over for more information) d3cpha_, d3cphg1, d3cphg2, d3cphg3 |