Lineage for d3cphh1 (3cph H:7-301)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2849308Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2849309Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2849753Family c.3.1.3: GDI-like N domain [51931] (3 proteins)
    Similar to FAD-linked reductases in both domains but does not bind FAD
  6. Protein automated matches [254667] (1 species)
    not a true protein
  7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255774] (3 PDB entries)
  8. 2849778Domain d3cphh1: 3cph H:7-301 [156890]
    Other proteins in same PDB: d3cpha_, d3cphg2, d3cphg3, d3cphh2, d3cphh3
    automated match to d2bcgg1
    complexed with gdp, mg

Details for d3cphh1

PDB Entry: 3cph (more details), 2.9 Å

PDB Description: Crystal structure of Sec4 in complex with Rab-GDI
PDB Compounds: (H:) Rab GDP-dissociation inhibitor

SCOPe Domain Sequences for d3cphh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cphh1 c.3.1.3 (H:7-301) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dtdydvivlgtgitecilsgllsvdgkkvlhidkqdhyggeaasvtlsqlyekfkqnpis
keereskfgkdrdwnvdlipkflmangeltnilihtdvtryvdfkqvsgsyvfkqgkiyk
vpaneieaissplmgifekrrmkkflewissykeddlsthqgldldkntmdevyykfglg
nstkefighamalwtnddylqqparpsferillycqsvarygkspylypmyglgelpqgf
arlsaiyggtymldtpidevlykkdtgkfegvktklgtfkaplviadptyfpekc

SCOPe Domain Coordinates for d3cphh1:

Click to download the PDB-style file with coordinates for d3cphh1.
(The format of our PDB-style files is described here.)

Timeline for d3cphh1: