![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
![]() | Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) ![]() N-terminal domain is beta/beta/alpha common fold |
![]() | Domain d3cphg3: 3cph G:302-399 [156889] Other proteins in same PDB: d3cpha_, d3cphg1, d3cphg2, d3cphh1, d3cphh2 automated match to d2bcgg3 complexed with gdp, mg |
PDB Entry: 3cph (more details), 2.9 Å
SCOPe Domain Sequences for d3cphg3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cphg3 d.16.1.0 (G:302-399) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} kstgqrviraicilnhpvpntsnadslqiiipqsqlgrksdiyvaivsdahnvcskghyl aiistiietdkphielepafkllgpieekfmgiaelfe
Timeline for d3cphg3:
![]() Domains from other chains: (mouse over for more information) d3cpha_, d3cphh1, d3cphh2, d3cphh3 |