| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) ![]() |
| Domain d3cphg2: 3cph G:400-445 [156888] Other proteins in same PDB: d3cpha_, d3cphg1, d3cphg3, d3cphh1, d3cphh3 automated match to d2bcgg2 complexed with gdp, mg |
PDB Entry: 3cph (more details), 2.9 Å
SCOPe Domain Sequences for d3cphg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cphg2 c.3.1.0 (G:400-445) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
predgskdniylsrsydasshfesmtddvkdiyfrvtghplvlkqr
Timeline for d3cphg2:
View in 3DDomains from other chains: (mouse over for more information) d3cpha_, d3cphh1, d3cphh2, d3cphh3 |