Lineage for d3cp1a_ (3cp1 A:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3042053Superfamily h.3.2: Virus ectodomain [58069] (2 families) (S)
  5. 3042054Family h.3.2.1: Virus ectodomain [58070] (9 proteins)
  6. 3042100Protein Retrovius gp41 protease-resistant core [58071] (4 species)
    coiled coil; biological unit: trimer
  7. 3042101Species Human immunodeficiency virus type 1 [TaxId:11676] [58072] (26 PDB entries)
  8. 3042123Domain d3cp1a_: 3cp1 A: [156885]
    automated match to d3cyoa1
    mutant

Details for d3cp1a_

PDB Entry: 3cp1 (more details), 2 Å

PDB Description: structure of a longer thermalstable core domain of hiv-1 gp41 containing the enfuvirtide resistance mutation n43d
PDB Compounds: (A:) Transmembrane Protein

SCOPe Domain Sequences for d3cp1a_:

Sequence, based on SEQRES records: (download)

>d3cp1a_ h.3.2.1 (A:) Retrovius gp41 protease-resistant core {Human immunodeficiency virus type 1 [TaxId: 11676]}
tvqarqllsgivqqqndllraieaqqhllqltvwgikqlqarsggrggwmewdreinnyt
slihslieesqnqqekneqelle

Sequence, based on observed residues (ATOM records): (download)

>d3cp1a_ h.3.2.1 (A:) Retrovius gp41 protease-resistant core {Human immunodeficiency virus type 1 [TaxId: 11676]}
tvqarqllsgivqqqndllraieaqqhllqltvwgikqlmewdreinnytslihsliees
qnqqekneqelle

SCOPe Domain Coordinates for d3cp1a_:

Click to download the PDB-style file with coordinates for d3cp1a_.
(The format of our PDB-style files is described here.)

Timeline for d3cp1a_: