SCOPe 2.08: Domain d3coqb1: 3coq B:8-48

Lineage for d3coqb1 (3coq B:8-48)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.38: Zn2/Cys6 DNA-binding domain [57700] (1 superfamily)
   all-alpha dimetal(zinc)-bound fold

4. Superfamily g.38.1: Zn2/Cys6 DNA-binding domain [57701] (1 family)
   duplication: two structural repeats are related by the pseudo dyad

5. Family g.38.1.1: Zn2/Cys6 DNA-binding domain [57702] (6 proteins)

6. Protein Gal4 [57703] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57704] (3 PDB entries)

8. Domain d3coqb1: 3coq B:8-48 [156875]
   Other proteins in same PDB: d3coqa2, d3coqb2
   automatically matched to d1d66a1
   protein/DNA complex; complexed with mpd, zn

Details for d3coqb1

PDB Entry: 3coq, 2.4 Å

PDB Description: structural basis for dimerization in dna recognition by gal4

PDB Compounds: (B:) regulatory protein gal4

SCOPe Domain Sequences for d3coqb1:

Sequence; same for both SEQRES and ATOM records:

>d3coqb1 g.38.1.1 (B:8-48) Gal4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eqacdicrlkklkcskekpkcakclknnwecryspktkrsp

Timeline for d3coqb1:

• d3coqb1 first appeared in SCOP 1.75
  
• d3coqb1 appears in SCOPe 2.07