Class g: Small proteins [56992] (90 folds) |
Fold g.38: Zn2/Cys6 DNA-binding domain [57700] (1 superfamily) all-alpha dimetal(zinc)-bound fold |
Superfamily g.38.1: Zn2/Cys6 DNA-binding domain [57701] (1 family) duplication: two structural repeats are related by the pseudo dyad |
Family g.38.1.1: Zn2/Cys6 DNA-binding domain [57702] (6 proteins) |
Protein Gal4 [57703] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57704] (3 PDB entries) |
Domain d3coqa1: 3coq A:8-48 [156873] Other proteins in same PDB: d3coqa2, d3coqb2 automatically matched to d1d66a1 protein/DNA complex; complexed with mpd, zn |
PDB Entry: 3coq (more details), 2.4 Å
SCOPe Domain Sequences for d3coqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3coqa1 g.38.1.1 (A:8-48) Gal4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} eqacdicrlkklkcskekpkcakclknnwecryspktkrsp
Timeline for d3coqa1: